Got1 (Mouse) Recombinant Protein
  • Got1 (Mouse) Recombinant Protein

Got1 (Mouse) Recombinant Protein

Ref: AB-P7933
Got1 (Mouse) Recombinant Protein

Información del producto

Mouse Got1 (P05201, 1 a.a. - 413 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Got1
Gene Alias AI789014|Got-1|cAspAT
Gene Description glutamate oxaloacetate transaminase 1, soluble
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPPSVFAQVPQAPPVLVFKLTADFRDDPDPRKVNLGVGAYRTDESQPWVLPVVRKVEQKIANDNSLNHEYLPILGLAEFRSCASRLVLGDNSLAIRENRVGGVQSLGGTGALRIGADFLGRWYNGTDNKNTPIYVSSPTWENHNAVFSAAGFKDIRPYCYWDAEKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIAAVMQRRFLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQ
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT)
Gene ID 14718

Enviar un mensaje


Got1 (Mouse) Recombinant Protein

Got1 (Mouse) Recombinant Protein