Got1 (Mouse) Recombinant Protein View larger

Mouse Got1 (P05201, 1 a.a. - 413 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P7933

New product

Got1 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name Got1
Gene Alias AI789014|Got-1|cAspAT
Gene Description glutamate oxaloacetate transaminase 1, soluble
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPPSVFAQVPQAPPVLVFKLTADFRDDPDPRKVNLGVGAYRTDESQPWVLPVVRKVEQKIANDNSLNHEYLPILGLAEFRSCASRLVLGDNSLAIRENRVGGVQSLGGTGALRIGADFLGRWYNGTDNKNTPIYVSSPTWENHNAVFSAAGFKDIRPYCYWDAEKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIAAVMQRRFLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQ
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT)
Gene ID 14718

More info

Mouse Got1 (P05201, 1 a.a. - 413 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Mouse Got1 (P05201, 1 a.a. - 413 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Mouse Got1 (P05201, 1 a.a. - 413 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.