Ver mas grande
TNFSF15 (Human) Recombinant Protein
AB-P7911
Producto nuevo
TNFSF15 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | TNFSF15 |
| Gene Alias | MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 15 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.5 (40% glycerol) |
| Gene ID | 9966 |
Más información
Human TNFSF15 (O95150, 72 a.a. - 251 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.