TNFSF15 (Human) Recombinant Protein
  • TNFSF15 (Human) Recombinant Protein

TNFSF15 (Human) Recombinant Protein

Ref: AB-P7911
TNFSF15 (Human) Recombinant Protein

Información del producto

Human TNFSF15 (O95150, 72 a.a. - 251 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name TNFSF15
Gene Alias MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A
Gene Description tumor necrosis factor (ligand) superfamily, member 15
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.5 (40% glycerol)
Gene ID 9966

Enviar uma mensagem


TNFSF15 (Human) Recombinant Protein

TNFSF15 (Human) Recombinant Protein