Ver mas grande
CD9 (Human) Recombinant Protein
AB-P7892
Producto nuevo
CD9 (Human) Recombinant Protein
Comprando este producto generará 17 Biopuntos. Su cesta contiene un total 17 Biopuntos puede ser convertido en un Biobonos Descuento 68.00EUR.
Hoja técnica
| Size | 500 ug |
| Gene Name | CD9 |
| Gene Alias | 5H9|BA2|BTCC-1|DRAP-27|GIG2|MIC3|MRP-1|P24|TSPAN29 |
| Gene Description | CD9 molecule |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol) |
| Gene ID | 928 |
Más información
Human CD9 (P21926, 112 a.a. - 195 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.