CD9 (Human) Recombinant Protein
  • CD9 (Human) Recombinant Protein

CD9 (Human) Recombinant Protein

Ref: AB-P7892
CD9 (Human) Recombinant Protein

Información del producto

Human CD9 (P21926, 112 a.a. - 195 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 500 ug
Gene Name CD9
Gene Alias 5H9|BA2|BTCC-1|DRAP-27|GIG2|MIC3|MRP-1|P24|TSPAN29
Gene Description CD9 molecule
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 928

Enviar uma mensagem


CD9 (Human) Recombinant Protein

CD9 (Human) Recombinant Protein