View larger
Human CD9 (P21926, 112 a.a. - 195 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
AB-P7892
New product
CD9 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 17 pontos de fidelização. Seu carrinho totalizará 17 pontos de fidelização que podem ser convertidos num vale de desconto de 68.00EUR.
Data sheet
| Size | 500 ug |
| Gene Name | CD9 |
| Gene Alias | 5H9|BA2|BTCC-1|DRAP-27|GIG2|MIC3|MRP-1|P24|TSPAN29 |
| Gene Description | CD9 molecule |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol) |
| Gene ID | 928 |
More info
Human CD9 (P21926, 112 a.a. - 195 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.