Ver mas grande
KLRF1 (Human) Recombinant Protein
AB-P7891
Producto nuevo
KLRF1 (Human) Recombinant Protein
Comprando este producto generará 19 Biopuntos. Su cesta contiene un total 19 Biopuntos puede ser convertido en un Biobonos Descuento 76.00EUR.
Hoja técnica
| Size | 500 ug |
| Gene Name | KLRF1 |
| Gene Alias | CLEC5C|MGC119907|MGC119908|MGC119909 |
| Gene Description | killer cell lectin-like receptor subfamily F, member 1 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | DGSLLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQYLEPKSCDRTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol) |
| Gene ID | 51348 |
Más información
Human KLRF1 (Q9NZS2, 60 a.a. - 231 a.a.) partial recombinant protein with hIgG-His tag expressed in HEK293 cells.