KLRF1 (Human) Recombinant Protein
  • KLRF1 (Human) Recombinant Protein

KLRF1 (Human) Recombinant Protein

Ref: AB-P7891
KLRF1 (Human) Recombinant Protein

Información del producto

Human KLRF1 (Q9NZS2, 60 a.a. - 231 a.a.) partial recombinant protein with hIgG-His tag expressed in HEK293 cells.
Información adicional
Size 500 ug
Gene Name KLRF1
Gene Alias CLEC5C|MGC119907|MGC119908|MGC119909
Gene Description killer cell lectin-like receptor subfamily F, member 1
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DGSLLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQYLEPKSCDRTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 51348

Enviar uma mensagem


KLRF1 (Human) Recombinant Protein

KLRF1 (Human) Recombinant Protein