View larger
Human KLRF1 (Q9NZS2, 60 a.a. - 231 a.a.) partial recombinant protein with hIgG-His tag expressed in HEK293 cells.
AB-P7891
New product
KLRF1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 19 pontos de fidelização. Seu carrinho totalizará 19 pontos de fidelização que podem ser convertidos num vale de desconto de 76.00EUR.
Data sheet
| Size | 500 ug |
| Gene Name | KLRF1 |
| Gene Alias | CLEC5C|MGC119907|MGC119908|MGC119909 |
| Gene Description | killer cell lectin-like receptor subfamily F, member 1 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | DGSLLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQYLEPKSCDRTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol) |
| Gene ID | 51348 |
More info
Human KLRF1 (Q9NZS2, 60 a.a. - 231 a.a.) partial recombinant protein with hIgG-His tag expressed in HEK293 cells.