Ver mas grande
Il21r (Mouse) Recombinant Protein
AB-P7886
Producto nuevo
Il21r (Mouse) Recombinant Protein
Comprando este producto generará 19 Biopuntos. Su cesta contiene un total 19 Biopuntos puede ser convertido en un Biobonos Descuento 76.00EUR.
Hoja técnica
| Size | 500 ug |
| Gene Name | Il21r |
| Gene Alias | NILR |
| Gene Description | interleukin 21 receptor |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDPHLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 ( 10% glycerol) |
| Gene ID | 60504 |
Más información
Mouse Il21r (Q9JHX3, 20 a.a. - 237 a.a.) partial recombinant protein with hIgG-His tag expressed in HEK293 cells.