Il21r (Mouse) Recombinant Protein
  • Il21r (Mouse) Recombinant Protein

Il21r (Mouse) Recombinant Protein

Ref: AB-P7886
Il21r (Mouse) Recombinant Protein

Información del producto

Mouse Il21r (Q9JHX3, 20 a.a. - 237 a.a.) partial recombinant protein with hIgG-His tag expressed in HEK293 cells.
Información adicional
Size 500 ug
Gene Name Il21r
Gene Alias NILR
Gene Description interleukin 21 receptor
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDPHLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 ( 10% glycerol)
Gene ID 60504

Enviar uma mensagem


Il21r (Mouse) Recombinant Protein

Il21r (Mouse) Recombinant Protein