Ver mas grande
MAP2K6 (Human) Recombinant Protein
AB-P7871
Producto nuevo
MAP2K6 (Human) Recombinant Protein
Comprando este producto generará 17 Biopuntos. Su cesta contiene un total 17 Biopuntos puede ser convertido en un Biobonos Descuento 68.00EUR.
Hoja técnica
| Size | 500 ug |
| Gene Name | MAP2K6 |
| Gene Alias | MAPKK6|MEK6|MKK6|PRKMK6|SAPKK3 |
| Gene Description | mitogen-activated protein kinase kinase 6 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRF |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 ( 20% glycerol) |
| Gene ID | 5608 |
Más información
Human MAP2K6 (P52564, 1 a.a. - 334 a.a.) full-length recombinant protein with His tag expressed in Baculovirus.