View larger
Human MAP2K6 (P52564, 1 a.a. - 334 a.a.) full-length recombinant protein with His tag expressed in Baculovirus.
AB-P7871
New product
MAP2K6 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 17 pontos de fidelização. Seu carrinho totalizará 17 pontos de fidelização que podem ser convertidos num vale de desconto de 68.00EUR.
Data sheet
| Size | 500 ug |
| Gene Name | MAP2K6 |
| Gene Alias | MAPKK6|MEK6|MKK6|PRKMK6|SAPKK3 |
| Gene Description | mitogen-activated protein kinase kinase 6 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRF |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 ( 20% glycerol) |
| Gene ID | 5608 |
More info
Human MAP2K6 (P52564, 1 a.a. - 334 a.a.) full-length recombinant protein with His tag expressed in Baculovirus.