AB-P7869
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.
Size | 500 ug |
Gene Name | IL17RB |
Gene Alias | CRL4|EVI27|IL17BR|IL17RH1|MGC5245 |
Gene Description | interleukin 17 receptor B |
Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCP |
Form | Liquid |
Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer | In PBS, pH 7.4 (10% glycerol) |
Gene ID | 55540 |