IL17RB (Human) Recombinant Protein
  • IL17RB (Human) Recombinant Protein

IL17RB (Human) Recombinant Protein

Ref: AB-P7869
IL17RB (Human) Recombinant Protein

Información del producto

Human IL17RB (Q9NRM6, 18 a.a. - 292 a.a.) partial recombinant protein with higG-His tag expressed in Baculovirus.
Información adicional
Size 500 ug
Gene Name IL17RB
Gene Alias CRL4|EVI27|IL17BR|IL17RH1|MGC5245
Gene Description interleukin 17 receptor B
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCP
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 55540

Enviar uma mensagem


IL17RB (Human) Recombinant Protein

IL17RB (Human) Recombinant Protein