View larger
Human IL17RB (Q9NRM6, 18 a.a. - 292 a.a.) partial recombinant protein with higG-His tag expressed in Baculovirus.
AB-P7869
New product
IL17RB (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 22 pontos de fidelização. Seu carrinho totalizará 22 pontos de fidelização que podem ser convertidos num vale de desconto de 88.00EUR.
Data sheet
| Size | 500 ug |
| Gene Name | IL17RB |
| Gene Alias | CRL4|EVI27|IL17BR|IL17RH1|MGC5245 |
| Gene Description | interleukin 17 receptor B |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCP |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol) |
| Gene ID | 55540 |
More info
Human IL17RB (Q9NRM6, 18 a.a. - 292 a.a.) partial recombinant protein with higG-His tag expressed in Baculovirus.