IFNA1 (Porcine) Recombinant Protein
  • IFNA1 (Porcine) Recombinant Protein

IFNA1 (Porcine) Recombinant Protein

Ref: AB-P7861
IFNA1 (Porcine) Recombinant Protein

Información del producto

Porcine IFNA1 (Q6VAB8, 24 a.a. - 189 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name IFNA1
Gene Alias IFN-ALPHA-1|IFN1@
Gene Description interferon alpha-1
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQEAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Pig
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 397686

Enviar un mensaje


IFNA1 (Porcine) Recombinant Protein

IFNA1 (Porcine) Recombinant Protein