AB-P7861
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Size | 50 ug |
Gene Name | IFNA1 |
Gene Alias | IFN-ALPHA-1|IFN1@ |
Gene Description | interferon alpha-1 |
Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQEAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE |
Form | Liquid |
Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Pig |
Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer | In PBS, pH 7.4 (10% glycerol) |
Gene ID | 397686 |