AB-P7855
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 20 ug |
Gene Name | TGFA |
Gene Alias | TFGA |
Gene Description | transforming growth factor, alpha |
Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots should be stored at-20ºC to -80ºC. This product is stable for one year. <br>Avoid repeated freeze/thaw cycles. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA with polyhistidine tag at the C-terminus. |
Form | Lyophilized |
Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
Gene ID | 7039 |