View larger
Human TGFA recombinant protein with polyhistidine tag at the C-terminus expressed in <i>Escherichia coli</i>.
AB-P7855
New product
TGFA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | TGFA |
| Gene Alias | TFGA |
| Gene Description | transforming growth factor, alpha |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots should be stored at-20ºC to -80ºC. This product is stable for one year. <br>Avoid repeated freeze/thaw cycles. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA with polyhistidine tag at the C-terminus. |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 7039 |
More info
Human TGFA recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.