LGALS8 (Human) Recombinant Protein
  • LGALS8 (Human) Recombinant Protein

LGALS8 (Human) Recombinant Protein

Ref: AB-P7836
LGALS8 (Human) Recombinant Protein

Información del producto

Human LGALS8 recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name LGALS8
Gene Alias Gal-8|PCTA-1|PCTA1|Po66-CBP
Gene Description lectin, galactoside-binding, soluble, 8
Storage Conditions Lyophilized protein should be stored at -20C. Protein aliquots should be stored at-20C to -80C. This product is stable for one year.
Avoid repeated freeze/thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNI
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 3964

Enviar un mensaje


LGALS8 (Human) Recombinant Protein

LGALS8 (Human) Recombinant Protein