AB-P7836
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 20 ug |
Gene Name | LGALS8 |
Gene Alias | Gal-8|PCTA-1|PCTA1|Po66-CBP |
Gene Description | lectin, galactoside-binding, soluble, 8 |
Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots should be stored at-20ºC to -80ºC. This product is stable for one year. <br>Avoid repeated freeze/thaw cycles. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | MLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNI |
Form | Lyophilized |
Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
Gene ID | 3964 |