LGALS8 (Human) Recombinant Protein View larger

Human LGALS8 recombinant protein with polyhistidine tag at the N-terminus expressed in <i>Escherichia coli</i>.

AB-P7836

New product

LGALS8 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 20 ug
Gene Name LGALS8
Gene Alias Gal-8|PCTA-1|PCTA1|Po66-CBP
Gene Description lectin, galactoside-binding, soluble, 8
Storage Conditions Lyophilized protein should be stored at -20ºC. Protein aliquots should be stored at-20ºC to -80ºC. This product is stable for one year. <br>Avoid repeated freeze/thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNI
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 3964

More info

Human LGALS8 recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.

Enviar uma mensagem

Human LGALS8 recombinant protein with polyhistidine tag at the N-terminus expressed in <i>Escherichia coli</i>.

Human LGALS8 recombinant protein with polyhistidine tag at the N-terminus expressed in <i>Escherichia coli</i>.