AB-P7788
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.
Size | 500 ug |
Gene Name | FOLR1 |
Gene Alias | FBP|FOLR|FR-alpha|MOv18 |
Gene Description | folate receptor 1 (adult) |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS |
Form | Liquid |
Recomended Dilution | SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
Storage Buffer | In 20mM Tris-HCl buffer, pH8.0 (10% glycerol). |
Gene ID | 2348 |