FOLR1 (Human) Recombinant Protein Ver mas grande

FOLR1 (Human) Recombinant Protein

AB-P7788

Producto nuevo

FOLR1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.


Hoja técnica

Size 500 ug
Gene Name FOLR1
Gene Alias FBP|FOLR|FR-alpha|MOv18
Gene Description folate receptor 1 (adult)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS
Form Liquid
Recomended Dilution SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).
Gene ID 2348

Más información

Human FOLR1 (NP_057936, 25 a.a. - 234 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

FOLR1 (Human) Recombinant Protein

FOLR1 (Human) Recombinant Protein