FOLR1 (Human) Recombinant Protein
  • FOLR1 (Human) Recombinant Protein

FOLR1 (Human) Recombinant Protein

Ref: AB-P7788
FOLR1 (Human) Recombinant Protein

Información del producto

Human FOLR1 (NP_057936, 25 a.a. - 234 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name FOLR1
Gene Alias FBP|FOLR|FR-alpha|MOv18
Gene Description folate receptor 1 (adult)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).
Gene ID 2348

Enviar uma mensagem


FOLR1 (Human) Recombinant Protein

FOLR1 (Human) Recombinant Protein