FOLR1 (Human) Recombinant Protein View larger

Human FOLR1 (NP_057936, 25 a.a. - 234 a.a ) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P7788

New product

FOLR1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.


Data sheet

Size 500 ug
Gene Name FOLR1
Gene Alias FBP|FOLR|FR-alpha|MOv18
Gene Description folate receptor 1 (adult)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS
Form Liquid
Recomended Dilution SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).
Gene ID 2348

More info

Human FOLR1 (NP_057936, 25 a.a. - 234 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human FOLR1 (NP_057936, 25 a.a. - 234 a.a ) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human FOLR1 (NP_057936, 25 a.a. - 234 a.a ) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.