Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
AKT1 (Human) Recombinant Protein
Abnova
AKT1 (Human) Recombinant Protein
Ref: AB-P7766
AKT1 (Human) Recombinant Protein
Contáctenos
Información del producto
Human AKT1 (NP_004842, 64 a.a. - 420 a.a ) partial recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
250 ug
Gene Name
AKT1
Gene Alias
AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA
Gene Description
v-akt murine thymoma viral oncogene homolog 1
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEE
Form
Liquid
Recomended Dilution
SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Quality control testing
3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer
In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).
Gene ID
207
Enviar un mensaje
AKT1 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*