Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
AKT1 (Human) Recombinant Protein
Abnova
AKT1 (Human) Recombinant Protein
Ref: AB-P7766
AKT1 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human AKT1 (NP_004842, 64 a.a. - 420 a.a ) partial recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
250 ug
Gene Name
AKT1
Gene Alias
AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA
Gene Description
v-akt murine thymoma viral oncogene homolog 1
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEE
Form
Liquid
Recomended Dilution
SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Quality control testing
3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer
In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).
Gene ID
207
Enviar uma mensagem
AKT1 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*