VEGFA (Human) Recombinant Protein
  • VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein

Ref: AB-P7723
VEGFA (Human) Recombinant Protein

Información del producto

Human VEGFA (NP_001165097, 27 a.a. - 191 a.a ) partial recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name VEGFA
Gene Alias MGC70609|VEGF|VEGF-A|VPF
Gene Description vascular endothelial growth factor A
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (0.1mM PMSF, 1 mM DTT, 30% glycerol).
Gene ID 7422

Enviar un mensaje


VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein