View larger
Human VEGFA (NP_001165097, 27 a.a. - 191 a.a ) partial recombinant protein with His tag expressed in <i>Baculovirus</i> expressi
AB-P7723
New product
VEGFA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | VEGFA |
| Gene Alias | MGC70609|VEGF|VEGF-A|VPF |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In PBS, pH 7.4 (0.1mM PMSF, 1 mM DTT, 30% glycerol). |
| Gene ID | 7422 |
More info
Human VEGFA (NP_001165097, 27 a.a. - 191 a.a ) partial recombinant protein with His tag expressed in Baculovirus expression system.