PDGFB (Human) Recombinant Protein
  • PDGFB (Human) Recombinant Protein

PDGFB (Human) Recombinant Protein

Ref: AB-P7665
PDGFB (Human) Recombinant Protein

Información del producto

Human PDGFB (P01127, 82 a.a. - 190 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name PDGFB
Gene Alias FLJ12858|PDGF2|SIS|SSV|c-sis
Gene Description platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Form Lyophilized
Quality control testing 2 ug protein in Reducing and Non-Reducing SDS PAGE Stained with Coomassie Blue
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 5155

Enviar un mensaje


PDGFB (Human) Recombinant Protein

PDGFB (Human) Recombinant Protein