AB-P7665
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 10 ug |
Gene Name | PDGFB |
Gene Alias | FLJ12858|PDGF2|SIS|SSV|c-sis |
Gene Description | platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) |
Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Form | Lyophilized |
Quality control testing | 2 ug protein in Reducing and Non-Reducing SDS PAGE Stained with Coomassie Blue |
Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
Gene ID | 5155 |