Ver mas grande
TNFSF9 (Human) Recombinant Protein
AB-P7660
Producto nuevo
TNFSF9 (Human) Recombinant Protein
Comprando este producto generará 35 Biopuntos. Su cesta contiene un total 35 Biopuntos puede ser convertido en un Biobonos Descuento 140.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | TNFSF9 |
| Gene Alias | 4-1BB-L|CD137L |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 9 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Form | Lyophilized |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 8744 |
Más información
Human TNFSF9 (P41273, 71 a.a. - 254 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.