TNFSF9 (Human) Recombinant Protein
  • TNFSF9 (Human) Recombinant Protein

TNFSF9 (Human) Recombinant Protein

Ref: AB-P7660
TNFSF9 (Human) Recombinant Protein

Información del producto

Human TNFSF9 (P41273, 71 a.a. - 254 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name TNFSF9
Gene Alias 4-1BB-L|CD137L
Gene Description tumor necrosis factor (ligand) superfamily, member 9
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Form Lyophilized
Quality control testing SDS-PAGE under reducing condition
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 8744

Enviar uma mensagem


TNFSF9 (Human) Recombinant Protein

TNFSF9 (Human) Recombinant Protein