View larger
Human TNFSF9 (P41273, 71 a.a. - 254 a.a.) partial recombinant protein with His tag at C-terminus expressed in <i>Escherichia col
AB-P7660
New product
TNFSF9 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 35 pontos de fidelização. Seu carrinho totalizará 35 pontos de fidelização que podem ser convertidos num vale de desconto de 140.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | TNFSF9 |
| Gene Alias | 4-1BB-L|CD137L |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 9 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Form | Lyophilized |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 8744 |
More info
Human TNFSF9 (P41273, 71 a.a. - 254 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.