MUC16 (Human) Recombinant Protein
  • MUC16 (Human) Recombinant Protein

MUC16 (Human) Recombinant Protein

Ref: AB-P7658
MUC16 (Human) Recombinant Protein

Información del producto

Human MUC16 (Q8WXI7, 12660 a.a. - 12923 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Expi293 cells.
Información adicional
Size 100 ug
Gene Name MUC16
Gene Alias CA125|FLJ14303
Gene Description mucin 16, cell surface associated
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGT_x005F_x005F_x005F_x000D__x005F_x000D_12841PSSLPSPTSAGPLLVPFTLNFTITNLQYEED
Form Lyophilized
Quality control testing SDS-PAGE under reducing condition
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 94025

Enviar un mensaje


MUC16 (Human) Recombinant Protein

MUC16 (Human) Recombinant Protein