View larger
Human MUC16 (Q8WXI7, 12660 a.a. - 12923 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Expi293 ce
AB-P7658
New product
MUC16 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | MUC16 |
| Gene Alias | CA125|FLJ14303 |
| Gene Description | mucin 16, cell surface associated |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGT_x005F_x005F_x005F_x000D__x005F_x000D_12841PSSLPSPTSAGPLLVPFTLNFTITNLQYEED |
| Form | Lyophilized |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 94025 |
More info
Human MUC16 (Q8WXI7, 12660 a.a. - 12923 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Expi293 cells.