CD40 (Human) Recombinant Protein
  • CD40 (Human) Recombinant Protein

CD40 (Human) Recombinant Protein

Ref: AB-P7655
CD40 (Human) Recombinant Protein

Información del producto

Human CD40 (P25942, 21 a.a. - 193 a.a.) partial recombinant protein with His tag at C-terminus expressed in Expi293 cells.
Información adicional
Size 100 ug
Gene Name CD40
Gene Alias Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene Description CD40 molecule, TNF receptor superfamily member 5
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Form Lyophilized
Quality control testing SDS-PAGE under reducing condition
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 958

Enviar un mensaje


CD40 (Human) Recombinant Protein

CD40 (Human) Recombinant Protein