View larger
Human CD40 (P25942, 21 a.a. - 193 a.a.) partial recombinant protein with His tag at C-terminus expressed in Expi293 cells.
AB-P7655
New product
CD40 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | CD40 |
| Gene Alias | Bp50|CDW40|MGC9013|TNFRSF5|p50 |
| Gene Description | CD40 molecule, TNF receptor superfamily member 5 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Form | Lyophilized |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 958 |
More info
Human CD40 (P25942, 21 a.a. - 193 a.a.) partial recombinant protein with His tag at C-terminus expressed in Expi293 cells.