TNFRSF8 (Human) Recombinant Protein
  • TNFRSF8 (Human) Recombinant Protein

TNFRSF8 (Human) Recombinant Protein

Ref: AB-P7653
TNFRSF8 (Human) Recombinant Protein

Información del producto

Human TNFRSF8 (P28908, 19 a.a. - 379 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 1 mg
Gene Name TNFRSF8
Gene Alias CD30|D1S166E|KI-1
Gene Description tumor necrosis factor receptor superfamily, member 8
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPC
Form Lyophilized
Quality control testing 2 ug protein in Reducing SDS PAGE
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 943

Enviar un mensaje


TNFRSF8 (Human) Recombinant Protein

TNFRSF8 (Human) Recombinant Protein