Ver mas grande
TNFRSF8 (Human) Recombinant Protein
AB-P7653
Producto nuevo
TNFRSF8 (Human) Recombinant Protein
Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | TNFRSF8 |
| Gene Alias | CD30|D1S166E|KI-1 |
| Gene Description | tumor necrosis factor receptor superfamily, member 8 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPC |
| Form | Lyophilized |
| Quality control testing | 2 ug protein in Reducing SDS PAGE |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 943 |
Más información
Human TNFRSF8 (P28908, 19 a.a. - 379 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.