View larger
Human TNFRSF8 (P28908, 19 a.a. - 379 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
AB-P7653
New product
TNFRSF8 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 22 pontos de fidelização. Seu carrinho totalizará 22 pontos de fidelização que podem ser convertidos num vale de desconto de 88.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | TNFRSF8 |
| Gene Alias | CD30|D1S166E|KI-1 |
| Gene Description | tumor necrosis factor receptor superfamily, member 8 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPC |
| Form | Lyophilized |
| Quality control testing | 2 ug protein in Reducing SDS PAGE |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 943 |
More info
Human TNFRSF8 (P28908, 19 a.a. - 379 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.