Ver mas grande
ROR1 (Human) Recombinant Protein
AB-P7652
Producto nuevo
ROR1 (Human) Recombinant Protein
Comprando este producto generará 26 Biopuntos. Su cesta contiene un total 26 Biopuntos puede ser convertido en un Biobonos Descuento 104.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | ROR1 |
| Gene Alias | MGC99659|NTRKR1|dJ537F10.1 |
| Gene Description | receptor tyrosine kinase-like orphan receptor 1 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEIL |
| Form | Lyophilized |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 4919 |
Más información
Human ROR1 (Q01973-1, 1 a.a. - 403 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in Expi293 cells.