View larger
Human ROR1 (Q01973-1, 1 a.a. - 403 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in Expi293 cells.
AB-P7652
New product
ROR1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 26 pontos de fidelização. Seu carrinho totalizará 26 pontos de fidelização que podem ser convertidos num vale de desconto de 104.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | ROR1 |
| Gene Alias | MGC99659|NTRKR1|dJ537F10.1 |
| Gene Description | receptor tyrosine kinase-like orphan receptor 1 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEIL |
| Form | Lyophilized |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 4919 |
More info
Human ROR1 (Q01973-1, 1 a.a. - 403 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in Expi293 cells.