ROR1 (Human) Recombinant Protein
  • ROR1 (Human) Recombinant Protein

ROR1 (Human) Recombinant Protein

Ref: AB-P7652
ROR1 (Human) Recombinant Protein

Información del producto

Human ROR1 (Q01973-1, 1 a.a. - 403 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in Expi293 cells.
Información adicional
Size 1 mg
Gene Name ROR1
Gene Alias MGC99659|NTRKR1|dJ537F10.1
Gene Description receptor tyrosine kinase-like orphan receptor 1
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEIL
Form Lyophilized
Quality control testing SDS-PAGE under reducing condition
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 4919

Enviar uma mensagem


ROR1 (Human) Recombinant Protein

ROR1 (Human) Recombinant Protein