Ver mas grande
MET (Human) Recombinant Protein
AB-P7648
Producto nuevo
MET (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MET |
| Gene Alias | AUTS9|HGFR|RCCP2|c-Met |
| Gene Description | met proto-oncogene (hepatocyte growth factor receptor) |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | ECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRII |
| Form | Lyophilized |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 4233 |
Más información
Human MET (P08581, 25 a.a. - 932 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Expi293 cells.