MET (Human) Recombinant Protein
  • MET (Human) Recombinant Protein

MET (Human) Recombinant Protein

Ref: AB-P7648
MET (Human) Recombinant Protein

Información del producto

Human MET (P08581, 25 a.a. - 932 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Expi293 cells.
Información adicional
Size 100 ug
Gene Name MET
Gene Alias AUTS9|HGFR|RCCP2|c-Met
Gene Description met proto-oncogene (hepatocyte growth factor receptor)
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRII
Form Lyophilized
Quality control testing SDS-PAGE under reducing condition
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 4233

Enviar uma mensagem


MET (Human) Recombinant Protein

MET (Human) Recombinant Protein