Cntf (Mouse) Recombinant Protein
  • Cntf (Mouse) Recombinant Protein

Cntf (Mouse) Recombinant Protein

Ref: AB-P7642
Cntf (Mouse) Recombinant Protein

Información del producto

Mouse Cntf (P51642, 2 a.a. - 198 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Cntf
Gene Alias AI429687|MGC41235
Gene Description ciliary neurotrophic factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq AFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 mg/mL
Gene ID 12803

Enviar un mensaje


Cntf (Mouse) Recombinant Protein

Cntf (Mouse) Recombinant Protein