Cntf (Mouse) Recombinant Protein View larger

Mouse Cntf (P51642, 2 a.a. - 198 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P7642

New product

Cntf (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 10 ug
Gene Name Cntf
Gene Alias AI429687|MGC41235
Gene Description ciliary neurotrophic factor
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq AFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 mg/mL
Gene ID 12803

More info

Mouse Cntf (P51642, 2 a.a. - 198 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Mouse Cntf (P51642, 2 a.a. - 198 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Mouse Cntf (P51642, 2 a.a. - 198 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.