CTSL (Human) Recombinant Protein Ver mas grande

CTSL (Human) Recombinant Protein

AB-P7640

Producto nuevo

CTSL (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 10 ug
Gene Name CTSL1
Gene Alias CATL|CTSL|FLJ31037|MEP
Gene Description cathepsin L1
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSE
Form Liquid
Storage Buffer In 20 mM HAc-NaAc, 150 mM NaCl, pH 4.5.
Gene ID 1514

Más información

Human CTSL (P07711, 18 a.a. - 333 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.

Consulta sobre un producto

CTSL (Human) Recombinant Protein

CTSL (Human) Recombinant Protein