CTSL (Human) Recombinant Protein View larger

Human CTSL (P07711, 18 a.a. - 333 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.

AB-P7640

New product

CTSL (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 10 ug
Gene Name CTSL1
Gene Alias CATL|CTSL|FLJ31037|MEP
Gene Description cathepsin L1
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSE
Form Liquid
Storage Buffer In 20 mM HAc-NaAc, 150 mM NaCl, pH 4.5.
Gene ID 1514

More info

Human CTSL (P07711, 18 a.a. - 333 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.

Enviar uma mensagem

Human CTSL (P07711, 18 a.a. - 333 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.

Human CTSL (P07711, 18 a.a. - 333 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.