CTSL (Human) Recombinant Protein
  • CTSL (Human) Recombinant Protein

CTSL (Human) Recombinant Protein

Ref: AB-P7640
CTSL (Human) Recombinant Protein

Información del producto

Human CTSL (P07711, 18 a.a. - 333 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.
Información adicional
Size 10 ug
Gene Name CTSL1
Gene Alias CATL|CTSL|FLJ31037|MEP
Gene Description cathepsin L1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSE
Form Liquid
Storage Buffer In 20 mM HAc-NaAc, 150 mM NaCl, pH 4.5.
Gene ID 1514

Enviar uma mensagem


CTSL (Human) Recombinant Protein

CTSL (Human) Recombinant Protein