Ver mas grande
SERPINB5 (Human) Recombinant Protein
AB-P7632
Producto nuevo
SERPINB5 (Human) Recombinant Protein
Comprando este producto generará 42 Biopuntos. Su cesta contiene un total 42 Biopuntos puede ser convertido en un Biobonos Descuento 168.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | SERPINB5 |
| Gene Alias | PI5|maspin |
| Gene Description | serpin peptidase inhibitor, clade B (ovalbumin), member 5 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKVCGAACSSKRSPIIDVKNDRDRVGHKSIPMRNLRARPAKCLS |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 5268 |
Más información
Human SERPINB5 (P36952-2, 1 a.a. - 231 a.a.) partial recombinant protein expressed in Escherichia coli.