SERPINB5 (Human) Recombinant Protein
  • SERPINB5 (Human) Recombinant Protein

SERPINB5 (Human) Recombinant Protein

Ref: AB-P7632
SERPINB5 (Human) Recombinant Protein

Información del producto

Human SERPINB5 (P36952-2, 1 a.a. - 231 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name SERPINB5
Gene Alias PI5|maspin
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 5
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKVCGAACSSKRSPIIDVKNDRDRVGHKSIPMRNLRARPAKCLS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 5268

Enviar uma mensagem


SERPINB5 (Human) Recombinant Protein

SERPINB5 (Human) Recombinant Protein