SERPINB5 (Human) Recombinant Protein View larger

Human SERPINB5 (P36952-2, 1 a.a. - 231 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P7632

New product

SERPINB5 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 42 pontos de fidelização. Seu carrinho totalizará 42 pontos de fidelização que podem ser convertidos num vale de desconto de 168.00EUR.


Data sheet

Size 1 mg
Gene Name SERPINB5
Gene Alias PI5|maspin
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 5
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKVCGAACSSKRSPIIDVKNDRDRVGHKSIPMRNLRARPAKCLS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 5268

More info

Human SERPINB5 (P36952-2, 1 a.a. - 231 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human SERPINB5 (P36952-2, 1 a.a. - 231 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human SERPINB5 (P36952-2, 1 a.a. - 231 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.