CXCL11 (Human) Recombinant Protein
  • CXCL11 (Human) Recombinant Protein

CXCL11 (Human) Recombinant Protein

Ref: AB-P7628
CXCL11 (Human) Recombinant Protein

Información del producto

Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name CXCL11
Gene Alias H174|I-TAC|IP-9|IP9|MGC102770|SCYB11|SCYB9B|b-R1
Gene Description chemokine (C-X-C motif) ligand 11
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Gene ID 6373

Enviar un mensaje


CXCL11 (Human) Recombinant Protein

CXCL11 (Human) Recombinant Protein