View larger
Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7628
New product
CXCL11 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 42 pontos de fidelização. Seu carrinho totalizará 42 pontos de fidelização que podem ser convertidos num vale de desconto de 168.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | CXCL11 |
| Gene Alias | H174|I-TAC|IP-9|IP9|MGC102770|SCYB11|SCYB9B|b-R1 |
| Gene Description | chemokine (C-X-C motif) ligand 11 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL |
| Gene ID | 6373 |
More info
Human CXCL11 (O14625, 22 a.a. - 94 a.a.) partial recombinant protein expressed in Escherichia coli.