CTSB (Human) Recombinant Protein Ver mas grande

CTSB (Human) Recombinant Protein

AB-P7626

Producto nuevo

CTSB (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 69 Biopuntos. Su cesta contiene un total 69 Biopuntos puede ser convertido en un Biobonos Descuento 276.00EUR.


Hoja técnica

Size 1 mg
Gene Name CTSB
Gene Alias APPS|CPSB
Gene Description cathepsin B
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTG
Form Liquid
Storage Buffer In PBS solution, pH 7.4
Gene ID 1508

Más información

Human CTSB (P07858, 18 a.a. - 339 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.

Consulta sobre un producto

CTSB (Human) Recombinant Protein

CTSB (Human) Recombinant Protein