CTSB (Human) Recombinant Protein
  • CTSB (Human) Recombinant Protein

CTSB (Human) Recombinant Protein

Ref: AB-P7626
CTSB (Human) Recombinant Protein

Información del producto

Human CTSB (P07858, 18 a.a. - 339 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.
Información adicional
Size 1 mg
Gene Name CTSB
Gene Alias APPS|CPSB
Gene Description cathepsin B
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTG
Form Liquid
Storage Buffer In PBS solution, pH 7.4
Gene ID 1508

Enviar un mensaje


CTSB (Human) Recombinant Protein

CTSB (Human) Recombinant Protein