View larger
Human CTSB (P07858, 18 a.a. - 339 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.
AB-P7626
New product
CTSB (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 69 pontos de fidelização. Seu carrinho totalizará 69 pontos de fidelização que podem ser convertidos num vale de desconto de 276.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | CTSB |
| Gene Alias | APPS|CPSB |
| Gene Description | cathepsin B |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTG |
| Form | Liquid |
| Storage Buffer | In PBS solution, pH 7.4 |
| Gene ID | 1508 |
More info
Human CTSB (P07858, 18 a.a. - 339 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.